Jump to content

Mirad/Word Families

From Wikibooks, open books for an open world
(Redirected from Unilingua/Word Families)

Doing / making (ser)

[edit | edit source]
ser to do/act seud agent


seem agency
sen action
aasen initiative
seyn act
seun business
seunud businessman
seon fact
seoj case
sej event
sejet incident
seb boss
sem studio
casem factory
jeser continue
ánser to cooperate
gèser to copy
jaser to prepare
zòser to undo
igser to hurry up
ojser to plan
egser to redo
aanser to unify
seser to have (sth) done
sener to activate
senan activity
senen activation

aser to act as action


asud actor
alser to operate
als operation
alsud operator
alsea operational
arser to effectuate


saer to execute saen execution


saud executor
saena executive
saler to accomplish
sal accomplishment


iser to have an effect is effect


ois zero effect
ujis purpose


user to cause us cause


usa causal
ùser to motivate
ùs motive
ùsen motivation
ùsea motivating
ùsena motivational
ulser to influence
uls influence
ulseá influential
us và is cause and effect

eser to function es function


esea functioning
esena functional
esud functionary
esem office

éser to work ésem worksite


éset job
éser to work
ésud worker
éstut engineer
ésán handiwork
éscén process
ésnic salary
ésnicud salaried emploée
ésep strike
ésepud striker
oyés unemployment
oyésud jobless person
oésea lazy
ésjub workday
oésjub holiday
ánés collaboration
ánésa collaborative
ánésud collaborator

sier to result siun result
osiun lack of result
suer to occasion suler to provoke


sul provocation
suleá provocative
sulud provocateur

seer to behave seen behavior


seena behavioral
seler to conduct oneself
séer to busy onself
séler to practice
séner to profess

íser to use ís use


ísud user
írser to exploit
írs exploitation
írseá exploitative
fiíser to put to good use
fuíser to misuse

úser to serve ús service


úsud server
fiúser to benefit
fuúser to serve poorly
úrser to be a slave to
úrs slavery
úrsud slave

Being/becoming (cer)

[edit | edit source]
cer to be cat creature, cyd subject
acer to become 
ocer to be nonexistent ocun nothing, ocuner to annihilate
icer come about, happen ic event, ijicer to originate, ujicer to end up, ujic fate, destiny, fuic misfortune
ucer to make, create, causeucud creator, ucun a creation, ucunán (all of) creation, uceá creative
ecer to existece there is/are, ecea available, ecen existence, oecea nonexistent
àcer to have, own, possessàcun possession, àcud (owner), àca own, utàc property, àser to make available
òcer to lack, needòc gap, òcea lacking, òser to deprive, òcler to need, òcleá necessary
can form, shapecaner to form, canòa shapeless, fucana malformed, canen formation, ózcan aspect, ficaner to reform, kácaner to transform, canáner to compose, áncaner to constitute, candrener to formulate
caun type,kindaacaun prototype, vicaun model, vácaun original, utcaun example, ajcaun precedent
caser to fabricatecasem factory
ceser to buildcesen construction, cesud builder, cesem building site, oceser to destrò, ocesen destruction, oceseá destructive
cun thing (concrete)cunán reality, ocuner to anihilate
acun elementacana elemental, acunéna elementary
con matter (abstract)gícon problem, kocon secret, kacon revelation, kécon case, égcon crisis
cin picturetecin figure, cìn mark, zocìn trace, utcìn character, pencìn track, ciun sign, siunet signal, mancin photograph, mancinar camera
cén fashionutcén genre, secén procedure
cún objectcúnet article, cúfi effects

Putting (ber)

[edit | edit source]
  ber to put  
  bler to carry brer to haul
aber to put on eber to stop ober to take off
áber to raise éber to contain óber to lower
baer to lean on beer to hold boer to hold up
barer to press (down on) beler to keep boler to support (from below)
báer to lift béer to block bóer to hang
báler to rouse béler to hold back, retain/conserve bóler to suspend
álber to elevate élber to hold steady ólber to lower
  ézber to insert ózber to extract
  ézbler to carry in ózbler to carry out
obaer to relieve obeer to release, let go oboer to drop
obaler to relax obeler to abandon oboler to shirk
  obéer to yield  
    obóer to depend
úzbaer to squeeze úzbeer to embrace úzboer to smash
úzbaler to pinch    
obéer to release
iber to receive   uber to send
bier to take   buer to give
íber to take away   úber to bring near
zíber to diffuse zeyber to transpose  
zíbler to carry around zèbler to carry across, transport  
biner to pull bener to hold buner to push
ézbiner to draw in ézbener to hold in ézbuner to push in
úbiner to attract úbener to hold near íbuner to repel
ózbiner to extract ózbener to hold out ózbuner to expel
ábiner to pull up ábener to hold high ábuner to push up
ónbiner to yank apart ónbener to hold apart ónbuner to shove apart
ánbiner to attract ánbener to adhere ánbuner to combine
vabier to accept   vabuer to volunteer;
zébirer to yank through   zéburer to stab (shove through)
kebier to choose   kebuer to disperse
vobier to refuse   vobuer to deny
embier to occupy   embuer to give way
gorcbier to take part   gorcbuer to give out shares
pitbier to fish    
jobier to borrow   jobuer to lend
émbier to replace   émbuer to resign
ánabier to collect   ónabuer to scatter
    buér to remit
    buler to accord
    bùler to attribute
    bùrer to concede
zòbier to take back   zòbuer to give back
ifbier to welcome   ifbuer to offer
    vegbuer to delegate
    ifbuler to consacrate
    ifbùler to dedicate
    ifburer to sacrifice
nucbier to bù   nicbuer to sell
nacbiler to expend   nacbuler to allocate
    ifburer to sacrifice
    bluér to confer
    zíbuer to distribute
obier to relinquish   obuer to deprive
bin receipts   bun donation
    ivbun gift
baner to gesticulate   boner be calm
baaner to shake   booner to be still
banler to shake  
 
bànler to shudder    
baneter to rock baaneter to vibrate  
abaner to caress    
albaner to wipe    
ovbaner to resist    
    bos quiet
    obos trouble
    bòs quiet
    obòs worry
    óbos care
    óbós anxiety
  bén manner
    búer to reach (out to)
    búner to touch
    brúner to contact
  bemer to maintain  

Going (per)

[edit | edit source]
  per to go  
aper to get on eper to stop oper to get off
paer to stand peer to stay poer to hang
áper to get up éper to intervene óper to get down
álper to rise/ascend élper to block ólper to sink'/descend'
âlper to climb up ôlper to bow
árper to soar   órper to tumble
áprer to scamper up ... ... óprer to collapse
páer to jump péer to stand still póer to drop
páner to leap péner to seize póner to dive
párer to shoot up pénuer to attack pórer to plummit
iper go (away)   uper to come
emiper to emigrate   emuper to immigrate
igiper to flee igeper to stop suddenly iguper to rush (toward)
jauper to come before, precede   jouper to come after, succeed
aíper to off with/take along   aúper to come along with/bring along
    zoâuper to pick up (and bring back)
zoíper to go back   zoúper to return (come back)
íper to go away   úper to approach
ílper to escape   úlper to come home
íbemper to go in exile ... ... ... ...
pier to depart   puer to arrive
jopier to get a headstart   jopuer to arrive ahead of/beat
igpier to flee    
piler to quit    
cper to carry    
ézcper to import zècper to transport ózcper to export
zòciper to take back zícper to propagate zòcuper to bring back
zàper to advance zèper to cross zòper to retreat
ánper to go together   ónper to separate
izper to head (straight)   uzper to veer, turn
zíper to tour   zúper to rotate
japer to precede jeper to go along joper to follow
zaper to go in front zeper to go in the middle zoper to go in back
ézper to enter zéper to go through ózper to exit
igper to run zoigper to chase after ugper to amble
ízper to pass up uzper to curve úzper to go around
kiper to limp képer to stagger kuper to avoid, sidestep
egézper to reinter azézper to invade egózper to reemerge
ifper to stroll ifpoper to tour ifpiper to cruise
  zéper to penetrate  
poper to travel képoper to shuttle back and forth zípoper to travel around
papier to take off (flying) paper to fly papuer to land
pepier to ride off peper to ride pepuer to park
pipier to set sail piper to sail pipuer to dock
tôaper to walk, step tuáper to crawl tôuper to tiptoe
pan motion pen seizure pon rest
paz dance    
paner to move pener to seize poner to rest
pazer to dance    
opaner to freeze opener to release oponer to stir
paaner to shake peener to catch pooner to stay
apaner to massage paaneter to vibrate  
alpaner to rub    
ópaner to reverse    
kipaner to stumble   kupaner to slide
ónpaner to break    
papaner to soar pepaner to skate pipaner to swim
ovpaner to block    
paneter to balance    
puner to throw punrer to hurl pùner to launch
púner to bump into    
prúner to crash into    
apéner to hit apéneter to batter  
apêner to tap    
apénler to beat    
ópéner to knock down    
ónpéner to break    
ónpêner to crack    
ónpléner to smash    
ónpléner to burst    
ónpréner to explode    
pénuer to attack ovpénuer to counter-attack opénuer to defend
páner to leap (up) péner to lunge póner to dive
ézpáner to jump in zépáner to jump through ózpáner to jump out
zàpáner to leap forward zèpáner to leap across zòpáner to leap backward
pénarer to whip páneter to skip peneter to step
  pòn respite pos peace

Saying/talking (der, daer)

[edit | edit source]
dier to ask der to say duer to propose
updier to invite ebdier to discuss  
dider to question doder to be silent duder to answer
vader to affirm veder to quibble voder to deny
váder to swear   vóder to lie
ávder to excuse évder to judge óvder to accuse
fivader to approve   fuvader to condemn
fider to praise   fuder to curse
avder to advocate   ovder to oppose
frider to glorify   fruder to blaspheme
  fúder to offend
  flúder to insult
  frúder to outrage
  ufúder to threaten
  fuébder to dispute
azder to shout egder to repeat ozder to whisper
jader to predict jeder to narrate joder to recount
ivder to thank   uvder to complain
ijder to introduce   ujder to conclude
fiader to recommend   fuader to criticize
ajder to evoke   ojder to promise
tider to understand   tuder to explain
ágder to elaborate   ógder to summarize
diler to beseech deler to announce duler to submit
direr to require dèler to declare  
daer to speak
ágdaer to ramble
ébdaer to conversefuébdaer to quarrel
dad languagedaun speechdod silence
din historydìn storydiin recitation
dún namezadún first nameabdún last name
dun worddlun phrasedrun sentence

Writing/reading (drer, déder)

[edit | edit source]
drer to writevédrer to correspond, dúndrer to sign, abdrer to inscribe, gèdrer to copy, ézdrer to register, zèdrer to transcribe, tuúdrer to type, tuúdra typewritten, tuúdrud typist, cindrer to draw, drecìn letter (of the alphabet), dresìna literal, drecìnán alphabet, drecìnána alphabetical drecìnánser to alphabetize, dra written, odra unwritten
droer to erasedroun erasure, droar eraser
dren script, dreud writer, drenet article, drenetán series of articles, ébdren letter, ébdrenán mail, tuádren manuscript, jadren preface, jodren postscript, dedren prose, candren formula, vádren spelling, védren correspondence, vidrenán literature (belles lettres), drenán scripture, dreden report, cunándren program
drèn textdrèna textual, óbdrèn subtext, zúdrèn context, zúdrèna contextual
déder to readdédud reader, dédudán readership, zídéder to scan, déd lecture, dédim lecture hall, dédar scanner
dén bookdénám book collection, dénánam library, dénunam bookstore, déngorc chapter, dénifud bookworm, dénabkum bookcover, dénembelar bookmark, déndúnán bibliography, dénet booklet, dindén storybook, novel, tiundén textbook
dreun document, filedreunán dossier, documentation, dreuner to document, file

'

drec notedrecer to note, dodrec bulletin
drecin drawing, designdreciner to draw, drecinud designer, drecinam design studio
drez poemdrezán poetry, drezet verse, drezut poet, drezéna poetic
dreván grammardrevána grammatical, drevánut grammarian
dréner to printdrén print, drénar printer, drénam printshop, jubdrén newspaper, jubdrénán the press, jubdrénud journalist, jobdrén magazine, cindrén illustration, zídrén poster, zídrénet prospectus, drénet ticket, ózdréner to publish, ózdrénam publishing house, dréncìn type, character (of a font), dréncìnán font, dréncìnánam foundry
drar pendrear pencil, dril ink
dof cardboard 
daf cardmircindaf map, ekdaf playing card, ébdrendaf postcard, dafán stack of cards
def paperdefán stationery, defánam stationery shop, defet scrap of paper, defcasam paper mill
dáf notebookdáfet book (of tickets, etc.), agdáf register
dúf sheet (of paper)dúfbuar sheetfeeder
dúv pagedúván ream of paper, mirmepán dúv web page, zàdúvper to page forward

Society (dot)

[edit | edit source]
dot societydota societal, dotcer to socialize (intr.)
dotin socialism, dotinat socialist
odota savage, barbaric, odotan savagery, barbarism, odotat savage, barbarian
dotús social welfare
dotvàcan social security
dotbén custom, more (n.)
dotbéna customary


ajdotbén tradition
ajdotbéna traditional
dotcén civilization, dotcéner to civilize

dat frienddata friendly, datcer to befriend, datan friendship
dàt girlfriend
daat buddy, daater to buddy around, daatan buddyship
ifdat sweetheart, ifdatan romance, ifdata romantic
odat enemy, odata inimical, ovdata hostile, ovdatan hostility
datibut host, dàtibut hostess, datibéa hospitable, datibéan hospitality
datupud guest, visitor, datupudim guestroom, datupudem reception area, datuper to be a guest, to visit, datup' visit
det comrade, companion, associatedetan comraderie, association, detcer to associate
àdet companion, àdetan company
dit citizendita civil, ditan citizenship, ditán citizenry
ditbén civility
doita civic
dut sir, Mr.dùt madam, Mrs., dután messieurs
dutet master, lad
dùtet miss, mademoiselle, young lady
duut sire
ditús civil service
dout bourgeoisdouta bourgeois (adj.), doutan bourgeoisie, doután bourgeoisie (coll.)
aut personauta personal
autbén personality
agaut personnage, v.i.p.
aután group, autána collective
autgran crowd, autgrana crowded, autgrancer to form a crowd
aut individualauta individual, autan individuality
anuta private, anutan privacy
aután group
áud communeáuda communal, áudan community, áudana comunity-related
áudin communism, áudinat communist
áut collectiveáuta collective
áutan collectivity
áutser to collectivize, áutin collectivism, áutinat collectivist
át everyoneáta everyone's
tán peopletána popular, tánikcer to populate, tánikca populated, tánika populous, tánukser todepopulate, also: tánòser to depopulate, tánuka unpopulated, deserted
táncág population, táncágtut demographics
tân populace
tánin populism, táninat populist
tánifa popular, tánifan popularity, tánifser to popularize, otánifa unpopular
tánbén custom, tánbéna customary

State (dob)

[edit | edit source]
realmchieffemale counterpart
dob statedeb leader 
adob empireadeb emperoradèb empress
edob kingdomedeb king, monorachedèb queen
idob principalityideb princeidèb princess
udob marquisateideb marquisidèb marquise
ódob earldomódeb countódèb countess
ádob baronyádeb baronádèb baroness
édob duchyédeb dukeédèb duchess
ídob domainídeb lordídèb lordess
údob tribeúdeb tribal chief 
tándob republictándeb president (of the republic) 

Government (dab)

[edit | edit source]
dab governmentdaber to govern
dabdren ordnance
daba government
dabzem government center, capital
andab autocracy
nacdab plutocracy
abdaber to dominate, abdabin imperialism, dabovper to revolt, dabovpen revolution
dabtun politics, dabtut politician, dabtuna political
daab administrationdaaber to administer
daaba administrative
deb chief, leaderdeber to lead, command
andeb dictator, autocrat
deban leadership
debán leadership (coll.)
debveg authority, debvegdren authorization
debòser to depose
debovper to rebel, debovpud rebel, debovpen rebellion, vodebder to prohibit, vodebden prohibition, debden order
doob nationdooba national
dooban nationality
doof flag, doobdeuz national anthem
dub ministerduba ministerial, dubam ministry
ózdub ambassador, ózdubam embassy
ózdubet consul, ózdubetam consulate
dek combatdeker to combat
dekpan fight, dekpaner to fight, dekpanud fighter
dopek battle, dopekem battlefield
dropek war, dropeker to wage war, dropekud warrior, dropekéna bellicose
damem metropolisdamema metropolitan
obdamam colony, obdamemser to colonize, obdamemsud colonialist
domem territorydomeam province/state, domeameb governor
domeem department (eg. of France), domeemeb prefect
domeim canton
domeum commune
dom citydoma urban, domaser to urbanize
dombén polity
úzdom suburb, domag metropolis
debdom capital, midom port, domgon district, domgob quarter, domeb mayor, domam mayor's office, domab municipality, domaba municipal
dòm town
doam borough
doem village
doim hamlet
domcin cityscape
domep boulevarddomèp avenue
domeap street
domeep lane
mepet alley
gacmep intersection
omep impasse, cul-de-sac, deadend
ábmep highway
igmep expressway
abzèmep bridge, overpass
obzèmep underpass
zémep tunnel
ízmep bypass, detour
úzmep beltway
ébdoma mep interstate highway (lit: intercity road)
domém squaredomzúm circle

Knowing (ter)

[edit | edit source]
tier to study
tiud student
titam school
atitam elementary school
etitam high school
ititam college
tin doctrine, -ism
ter to know
oter to ignore
keter to be curious
jàter to guess
egter to recognize
vater to believe
veter to wonder
voter to doubt
ten knowledge, information
tuer to teach
tuud teacher
tutam institute
tutamán university
tut expert, scholar, scientist
tun science, -ology
ticer to learn
ticun lesson
tecer to perceive, sense
tecun data
tucer to instruct
tucun instruction
tiser to agreeteser to think
tújteser to dream
ijtes idea
jotes afterthought
tuser to convince
akteser to remember okteser to forget
vateser to assumeveteser to supposevoteser to discount
váteser to believevéteser to wonder, weighvóteser to doubt
ánteser to agree ónteser to disagree
avteser to favorevteser to quibbleovteser to oppose
fiteser to thank futeser to regret
jàteser to plan jòteser to reflect
kateser to recallketeser to search one's memorykoteser to forget (deliberately)
keter to be interestedketen curiosity, ketea curious, ketenàa interesting, ketenukser to interest, oketer to be uninterested
 tújteser to dream 
tep mindtepa mentaltepén attitude,aztepa intelligent, vátepa wise, tepbén method, tepbéna methodical, otepa imbecile
tèp spirittèpa spiritualagtep genie
tez cultureteza culturalóbtez subculture, tezser to cultivate
tén industryténa industrialjoténa post-industrial,téntun technique, téntuna technical
tun sciencetuna scientifictut scholar
tin doctrinetina doctrinaltinéna doctrinaire
tún ideatúna idealtúncer conceive of, túnca conceptual, túnán ideology, túnánud ideolog
tekóer to pay attentiontekóa attentiveotekóa inattentive


Family (tod)

[edit | edit source]
tod familytoda familial
tòd home, tòda domestic
todana familiar
tad spouse, husbandtàd wife
tadán household
tadcer to get married, tadca married, tadcen marriage, tada marital
otadca unmarried, otadcat bachelor
tadòcat widower, tadòcàt widower, tadóncer
to divorce, tadóncat divorcee, tadónc divorce
tadán husband and wife team, jatad fiance, jatàd fiancee
tadceat groom, tàdceat bride, tàdceata bridal
tadet brother, tadeta fraternal, tadetan fraternity, tadetán fraternity (group), tàdetán sorority
tàdet sister
taodet brother-in-law
taódet sister-in-law
ted parent, fatherteda parental, paternal
tèd mother, tèda maternal
teda
tedòa orphaned, tedòat orphan, tedòan orphanhood, tedòcer to be orphaned, tedòatam orphanage
tedet son, tedeta filial
tèdet daughter
teodet son-in-law
teódet daughter-in-law
tid uncletidéna avuncular
tìd aunt
tidet cousin
tìdet cousin (female)
tud brother-in-lawtùd sister-in-law
tudet nephew
tùdet niece
tód father-in-lawtôd mother-in-law
tódet son-in-law
tôdet daughter-in-law
tád grandparent, grandfathertádéna grandfatherly
tâd grandmother, tâdéna grandmotherly
tádet grandson
tâdet granddaughter
tádán grandparents
tádetán grandchildren
téd relativetéda related, tédan kinship
tédcer to be related, tédán kin(folks), otéda unrelated
tíd god-parent, god-fathertídet godson
tîdet goddaughter
ajted ancestorajteda ancestral, ajtedán ancestry
jat ascendant 
jot descendantjòtan descendance

Human being (tob)

[edit | edit source]

tob human being
tab body
. taab lymph
.. taaba lymphatic
.. taabocet lymph gland
. taeb muscle
.. taeba muscular
. taib bone
.. taibán skeleton
... taibána skeletal
.. taibàa bony
.. taibcer ossify
... taibcen ossification
.. taibòa boneless
... taibòser to debone
. taob flesh
.. taoba carnal
... egtaobcen reincarnation
.. taobàa fleshy
.. taobtelea flesh-eating
.. potaob meat
... potaobtelea carnivorous
. taub cartilege
.. tauba cartilagenous
. taób skin
.. taóbil sweat
... taóbiler to sweat
... taóbilàa sweaty
.. petaób hide
.. taóf leather
... taófud leatherer
... taóféna leathery
. tàab fat
.. tàaba fat-related
.. tàabòa fat-free
.. tàabél lard
.. tàabil oil
... tàbiler to oil
... tàabilém oilcan
... tàabilàa oily
.. tàabàa fatty
. taéb hair
.. tàabàa hairy
.. taébòa bald
... taébòcer to go bald
... taébòat bald person
... taébòan baldness
... taébòser to depilate
.. taêb fuzz
... taêbàa fuzzy
.. pataéb feather
... pataébán plumage
.. petaéb mane
.. pitaéb scales
... pitaébàa scaly
.. taéf wig
. taíb nerve
.. taíba nervous
.. taíbaanea nerve-rattling
.. taíbzem nerve-center
. tap physique
.. tapa physical
.. íztapa metaphysical
.. taptun physiology
.. taptut physiologist
. taf suit [of clothes]
.. tàf dress
teb head
. tebném cranium
.. tebnéma cranial
. teboc brain
.. teboca cerebral
. ábteb forehead
. óbteb chin
. obteb neck
.. obteba cervical
.. zaobteb throat
.. zoobteb nape
. tebzan face
.. tebzana facial
.. tebzanábs face-lift
.. tebzanòa faceless
. teab eye
.. teaba ocular
.. teabéb eyebrow
.. teabil tear
... teabiler to weep
.. teabéb eyebrow
.. fateab eyelid
... fateabéb eyelash
.. zeteab pupil
.. anteaba one-eyed
.. teac sight
... teacer to see
... oteaca blind
.... oteacan blindness
.... oteacat blind person
.... oteacacer go blind
.... oteacaser to blind
... teacoker gain one's sight
... teacoker lose one's sight
... teacar eye glasses
.. teas look
... teaser to look
.... igteaser to glance
.... ágteaser to stare
.... uzteaser to look askance
.... izteaser to look directly in the eye
.. teabzúen eyeball
.. teaczéc eye socket
. teeb ear
.. teeba aural
.. fozteeb ear lobe
.. teec hearing
... teecer to hear
... teeca auditory
... teecier to listen
.... teeciud listener
..... teeciudán audience
.... teecien audition
.... teeciar listening device
... oteeca deaf
.... oteecser to deafen
..... oteecseá deafening
.... oteecat deaf person
.... oteecan deafness
... teecar hearing aid
.. ózteeb outer ear
. teib nose
.. teiba nasal
.. teibil snot
... teibila mucous
.. teiv handkerchief
.. ózteiber to sneeze
.. teic smell
... teicer to smell
... teica olfactory
... treic odor
.... treicàa odorous
... fiteic fragrance
... futeic stink
... teiz perfume
... teicier to sniff
.. teiceucer to snore
.. teibzéc nostril
. teob cheek
.. zeteob cheekbone
.. teobéb beard
... teobébàa bearded
... teobébòa beardless
. teub mouth
.. teuba oral
.. teubil saliva
... teubiler to salivate
.. ózteuber to spit
.. teubíjer to yawn
.. ézteuber to swallow
.. teubob lip
... teuboz smile
... teuboc kiss
... teuboba labial
.. teud shout
... teuder to scream
.. teuc taste
... teucer to taste
... fiteuca delicious
... futeuca nasty-tasting
.. teumib palate
... teumiba palatal
.. teubéb mustache
... teubébàa mustachioed
.. teubab tongue
... teubaba lingual
... teubaber to lick
... éztèbaber to suck
.. teubeb gum
.. teubib jaw
... teubiser to chew
.. teupib tooth
... teupiba dental
... teupibut dentist
.... teupibutam dentist's office
... teupicer to bite
.... teupicoger to nibble
... oteupiba toothless
... teupibán denture
. tef hat
.. tefet cap
.. tefud haberdasher
.. tefam haberdashery
. tep mind
.. tepa mental
.. tepcan sentiment
.. tepcana sentimental
. tes thought
.. teser to think
... ágteser to ponder
.. tesa cognitive
.. tesen cognition
.. teseá conceivable
.. oteseá inconceivable
.. tesoker to forget
... otesokeá unforgetable
.. tesaker to remember
. ter to know
.. oter to ignore
.. ota unknown
.. otea unaware
.. tuer to teach
... tuna scientific
... tut scientist
... tuen teaching
.... tuena didactic
... tuut teacher
.... tuután academe
... tun science
... tuun lesson
.. tier to learn
.. titam school
.. atitam grade school
.. etitam high school
.. ititam college
... tiud student
... tiudán student body
... tiun study
.... tiuna scholastic
.... tiunán studies, scholastics</i
... tin doctrine
.... tina doctrinal
.. tez culture
... teza cultural
.. ten knowledge
... tena awareness-related
.. teá known
.. tea aware
... tean awareness
. trer to recognize
.. tren cognizance
.. treá recognizable
.. trea cognizant
.. éztrer be conscious
.. éztren conscience
.. éztrea conscious
.. oéztrea unconscious
.. otra incognito
.. otrea incognizant
. tec perception
.. tecer to perceive
.. teceá perceptible
.. tecpan emotion
.. tecpana emotional
.. tecpanea emotive
.. tecpanean emotivity
.. tecpaneá excitable
.. tecpaner to emote
tib trunk
. zetib waist
.. tetibgan waist size
. zotib back
.. zotiba dorsal
.. zotibók back pain
. tiab chest
.. tilab breast
... tilabil, bil milk
.... tilabiler to lactate
.... tilabila lactic
.... tilabilbier to milk
.... tilabilbuer to give milk
.... tilabiléna milky
. tieb lung
.. tieba pulmonary
.. tieser to breathe
.. éztieser to inhale
.. óztieser to exhale
.. tiebok pneumonia
... tieboser to cough
. tiib heart
.. tiiba cardiac
.. tiibil blood
... tiibiler to bleed
... tiibilàa bloody
... tiibiloker to lose blood
... tiibilotila blood-thirsty
... tiibila sanguinary
... tiibilánam bloodbank
.. tiibuf artery
... tiibufa arterial
... tiibufog arteriole
... zòtiibuf vein
.... zòtiibufa venal
. tiub belly
.. tiuba ventral
.. tiùb abdomen
... tiùba abdominal
.. zetiub navel
.. zotiub buttock
. tiób kidney
.. tióba renal
.. tióbok kidney disease
.. tióbil urine
... tióbiler to urinate
... tióbilem urinal
... tióbila urinary
. tiáb penis
.. tiába penile
.. tìáb vagina
... tìába vaginal
.. ébtiába sexual
.. tiábcan phallus
... tiábcana phallic
.. tiábòser to castrate
.. tiábòcat castrato
.. tiáv condom
. tikob esophagus
.. tikoba esophageal
. tikab stomach
.. tikaba gastric
. tikeb liver
.. tikeba hepatic
.. tikebok hepatitis
.. tikebil bile
. tikib pancreas
.. tikiba pancreatic
. tikub instestine
.. tikuba instestinal
.. tikubil feces
... tikubila fecal
... tikubiler to defecate
.. tikubuj anus
... tikubuja anal
... tikubujbok proctitis
tub arm
. tuba brachial
. tuab shoulder
. tueb upper arm
. tuib elbow
.. tuiber to elbow
. tuub forearm
. tuób wrist
. tuáb hand
.. tuába manual
.. tuácer to handle
.. tuábier to grasp
.. tuábuer to lend a hand
.. tuúpúner to slap
.. ébtuáber to clasp/shake hands
.. tuápaner to clap/applaud
.. tuálpaner to massage/knead
.. tuásiner to sign
.. tuádotsiner to wave [hello/goodbye]
.. tuáf glove
... tuáfém glove compartment
... tuáfud glover
. tuéb fist
.. tuépaner to pound
. tuúb finger
.. tuúba digital
.. atuúb thumb
.. etuúb index
... etuúber to point
.. ituúb middle finger
.. utuúb ring finger
.. ótuúb little finger
.. tuúcer to feel
... tuúca tactile
... tuúceá palpable
.. tuúpaner to tap
.. tuúdrer to type
... tuúdrar typewriter, keyboard
.. tuúbuj finger tip
. tulob fingernail
.. tulocer to scratch
.. tulop claw
... tuloper to claw
. tuúb palm
.. tuúpaner to slap
. tulib knuckle
.. tulipaner to knock
tób leg
. tóab hip
.. tóaper to sit
. tóeb thigh
. tóib knee
.. tóiper to kneel
. tóub shin
. tôab foot
.. tôabektun podiatry
.. tôabektut podiatrist
.. tôaper to walk
... tôapud pedestrian
... tôapem sidewalk
... tôapar walker
... igtôaper to run
... igtôapem racetrack
.. tôapúner to kick
.. tôapaner to stomp
.. tôabar pedal
.. tôaf shoe
... tôafser to cobble
.... tôafsud shoemaker
.... tôafsam shoemaker's shop
.... tôafber to shoe
.... tôafba shod
... apetôaf horseshoe
... tôafmacil shoe polish
... tôafnífet shoelace
... tôafodet shoetack
. tôeb heel
.. tôepaner to supplant
. tôib sole
. tôub toe
.. tôuper to tiptoe
. tólob toenail
toba human
. tobaser to humanize
. otobaser to dehumanize
. toban humanity
. tobin humanism
.. tobina humanistic
.. tobinat humanist
. iftoba humanitarian
.. iftoban humanitarianism
tobán mankind
tobéna human
toob male
. tooba masculine
.. otoobaser to emasculate
.. tooban masculinity
. toòba feminine
.. toòban femininity
tooc sex
. tooca sexual
. toocan sexuality
. otooca asexual
. entooca bisexual
. hátooca pansexual
. getooca homosexual
.. getoocan homosexuality
.. getoocat homosexual [person]
tos instinct
. tosa instinctual
. toséna instintive
top soul
. toptun psychology
. toptuna psychological
. toptut psychologist
. topéna animate
.. topénaser to animate
.. topénasen animation
.. otopéna inanimate
. topòa soulless
tòb woman
. tòba female
.. eóntòba effeminate, quasi-female
. tòbéna feminine
.. otobéna unwomanly
. tòbet girl
.. tòbeténa girlish
.. tòbetan girlhood
. tòbán womankind
tobob child
. toboba infantile
.. toboban infancy
. tobéna childish
. tobobòa childless
. tobobikam child care center
tobet boy
. tobeténa boyish
. tobetan boyhood
tobog kid, midget
. tobòg kiddie
tobóg brat
tobag giant
. tobagéna gigantic
tobág monster
. tobágéna monstrous
toc sense
. toca sensorial
. tocan sensation
. tocer to sense
. toceá sensible
. tocea sensitive
boc organ
. boca organic
. bocán organism
. bocet gland
.. boceta glandular

Bodily functions (tab...er)

[edit | edit source]
body partbody function
tab bodyóbtaber to bow, stoop
áztaber to prostrate oneself
ábtaber to stand erect
teb headóbteber to duck
tebciner to nod
tep mindter to know, etc. [see Mental Activities]
teab eyeteacer to see
teaser to look
teabiler to weep
zóteaber to squint
ágteaser to stare
igteaser to glance
igteacer
to glimpse
teabciner
to wink
teabigíjer to blink
taéb hairtaébòcer to bald
taób skintaóbiler to sweat
taóboker to shed
taíb nervetaíser irritate
iftaíser to tickle
taícer to itch
teeb earteecer hear
teeser listen
teib noseteicer to smell
teiser to sniff
teiseucer to snore
teibiler to run at the nose
teibilpuner to sneeze
teibukser to blow the nose
teub mouthteubiler to salivate
teubilpuner to spit
ézteuber swallow
teubíjer to yawn
teuder to shout
teubob lipteubocer to kiss
éztèbober to suck
teubozer to smile
teucozer to laugh
teubab tongueteubaber to lick
teucer to taste
teubib jawteubiser to chew
teipid toothteupicer to bite
tilab breasttilabiler to lactate
tikab stomachtikabilpuner to vomit
tieb lungtieser to breath
éztieser to inhale
óztieser to exhale
tiebil phlegm
tiebukser to cough
tiib hearttiibiler to bleed
tiób kidneytióbiler to urinate
tuab shouldertuaber to shoulder
tuib elbowtuiber to elbow
tuáb handtuábier to grab
tuábuer to hand
tuáser to manipulate
ébtuáber to shake hands
tuáciner to wave
tuápéner to slap
tuápéneter to pat
tuálpaner to massage
tuúb fingertuúcer to feel
tuúpéneter to tap
tuúdrer to type
iztuúber to point
ivtuúcer to tickle
tuúbginer to poke
tuúser to strum, fiddle
tôab foottôapéner to kick
tôaper to walk
igtôaper to run
kitôaper to hobble
tôob kneetôocer to kneel
tôoper to crawl
tôeb heeltôepéner to stomp
tôub toetôuper to tiptoe
tulob nailtuloser to scratch

Bodily fluids and other liquids (tab...il)

[edit | edit source]
objectfluid
tab bodytabil humor
teab eyeteabil tear
teib noseteibil mucus, snot
tilab breastbil milk (tila dropped)
teub mouthteubil saliva, spit
tiib hearttiibil blood
tiób kidneytióbil urine, piss
tikeb livertikebil bile
tikub intestinetikubil feces, shit
taób skintaóbil perspiration, sweat
tieb lungtiebil phlegm, sputum
tobij seedtobijil semen
mam skymamil rain
vafáb grapevafil wine (vafáb shortened to vaf)
voz colorvozil paint
dr- writedril ink
mag firemagil petroleum
mag firemaagil fuel
mag firemaegil gasoline
mag firemaigil kerosene
meg rockmegil cement
magmeb volcanomagmebil lava (fire mountain liquid)
án togetheránil glue
mel groundmeil mud
tel foodtelil soup
ovob cerealovobil meal, porridge
bil milkbiel cream
fáb fruitfábil juice
afáb appleafábil apple juice
ufáb pruneufábil prune juice
lafáb orangelafábil orange juice
afáb appleafil cider (afáb shortened to af)
kafáb olivekafábél olive oil
vol vegetablevolél vegetable oil
levol beetlevolil beet juice
fab treefabil sap
ávob hopávil beer (ábov shortened to áv)
levaf ...levafil liqueur
level sugarlevil syrup (el < tel food, il < til drink)
tul platetulil sauce
m- naturemil water
mil watermiil liquid
óm iceómil dew
óm iceómbiil ice cream
t- human/animaltil drink
bek treatmentbekil medicine
bok illnessbokil poison
cafaéb tea leafcafaél tea (-b organism to -l liquid)
cefáb coffee beancefál coffee
 él oil
 fél wax
apelat beeapelatel honey (-el food)
apelat beeapelatél wax (-él oil)
c metaloidcil acid
ílom 80-electron metalloidílomil mercury
mam skymal air (mam shortened to ma)
mal airmeal gas
mal airmial vapor
amc 1-electron metalloidamcal hydrogen (-al gas)
ímc 8-electron metalloidímcal oxygen
émc 7-electron metalloidémcal azote

Health (bak)

[edit | edit source]
bak health
baka healthy
baker to be healthy
bakcer to heal
bakser to cure
baktun hygiene
baktut hygienist
bakam sanatorium
bakat healthy person
baktel health food
baktelam health food place
baak sanitation
baaka sanitary
obaaka unsanitary
baakser to sanitize
tabak physical health
tebak mental health
bàk safety
bàka safe
bàker to save
bàkser to make safe
bàksud savior
obàk danger, peril
obàka unsafe, dangerous
obàkser to endanger
bek treatment, remedy, cure
beka clinical
beker to treat
bekcer to heal [intr.]
bekser to heal [tr.]
bekler to cure, to remedy
beklacer to be cured
bektun medecine (practice of)
bektut doctor
bekam clinic, hospital, care facility
bekim hospital room
bekat patient
bekut care-giver, nurse
bekil medecine, drug
bekel pill
bekila medicinal
bekilam pharmacy
bekiler to medicate
tebektun psychiatry
tebektut psychiatrist
bekleá curable
obekleá incurable
obekeá untreatable
fubek mistreatment, abuse
fubeker to mistreat, to abuse
bok illness
boka sick
boker to be sick
bokcer to fall ill
bokser to sicken
boktun pathology
boktut pathologist
boktuna pathological
bokus pathogen
bokam hospital
bokamber to hospitalize
bokat patient
book fatigue
booka tired
bookcer to grow tired
bookser to tire
bookseá tiresome
bokil poison
bokiler to poison
bokiléna poisonous
obokilam detox facility
ombok cold
teibok influenza, flu
vúrbok infection
ambok inflammation
tebok mental illness
teboka mentally ill
tebokam insane asylum
tebokat mentally ill person
tebook boredom
tebooker to bore
tebookcer to grow bored
tebookca bored
oboker to cure, to heal, to save
obokut savior, healer
egbokcer to relapse
bik care
bikea careful
biker to care for
biktun nursing
biktut nurse
bikam care facility
bikat care patient
bikof bandage
bikofer to bandage
obik lack of care
obiker to leave uncared for
tebiker to care (about)
otebik apathy, lack of concern
otebiker to be unconcerned about
obikea careless
otebikea unconcerned, apathetic
igéga bik urgent care
igéga bikim emergency room
buk wound
buka wounded
buker to wound
bukcer to be wounded
bùk sore
buket scratch
buketer to scratch
bukof patch
bukofber to patch up
bukat trauma patient, victim
buuk harm
buuker to harm
buukeá harmful
buukòa harmless
buukék danger
bók pain
bôk ache
bôkcer to ache
bóker to hurt (someone)
bókcer to be in pain
bókeá painful
bókòa painless
bókòsil painkiller
bôker to ache
bóokcer to suffer
brók agony
bróker to torture
brókeá torturous
brókcer to agonize
tebók anguish
tebókcer to anguish

Clothes (tof)

[edit | edit source]
body partheavier materiallighter material
tob mantof appareltov underwear
tab bodytaf suitpontav pijama
teb headtef hattev scarf
teib noseteif nose coverteiv handkerchief
teób neckteóf tieteóv collar
tuab shouldertuaf shawl 
tib trunktif vest 
zetib waistzetif beltzetiv sash
tiab chestnefiaf sweatertiav shirt
tiub bellytiuf corsettiuv underpants
tilab breast tilav brassiere
tiáb penis tiáv loin cloth
tób legtóf pants 
tôab foottôaf shoetôav sock
tuáb handtuáf mit
tuáfém pocket
tuáv glove
tiúb tailtiúf train 

Habitation (tom)

[edit | edit source]
tom habitationtomer to live, tomud inhabitant
tòm home, tòma domestic
toem place of residence
toom accommodation, lodging, toomer to accommodate
tomet apartment, tometán apartment building
tomof tent
utom property
tomtun architecture, tomtut architect, tomtuna architectural
tombuer to lease,tombuud landlord, dren tombuena lease
tombier to rent, let, tombiud renter, lessee
tomnoc rent

tombel housekeeping, tombelud concierge
ábtom hi-rise
tém residencetémer to reside
témud resident
téma residential
vegdren témuda resident's permit
otémud non-resident
tam housetameb master of the house
taam villa
agtam chateau
ivagtam palace
ogtam cottage
tamet cabin
ogtamet hut
potam hotel, igpotam motel
zútam tower
azcatam castle
tamán housing complex
tamózem yard
tameézem courtyard
abtamac roof
zatam facade
telam restaurant
epam station
tilam bar
tuzam museum
dénam library
titam school
tutam institute
nunam store
cesam factory
avolam bakery
bikam hospital
totam church
tabekanam gym
milbam bathhouse
partam garage
beelam warehouse
vobésam farm
tàm buildingtàmser to build, otàmser to demolish, otàms ruins, tàmsud builder
tamcer to found, tamc foundation
mamtàm skyscraper
tem spaceabtem attic
obtem basement
ágtem gallery
pemepem parking lot
ponem rest stop
ifekem playground
dropekem battleground
maparem airport
ózem yard, outdoors
ázem flat space
úbem neighborhood
íbem the far side
kum side
abem top
obem bottom
zam front
zom back
zem middle
zém indoors
kunadam frontier
kim slope
ábem upstairs
óbem downstairs
zém tunnel
zèm bridge
ifpem promenade
mimkum beach
ifpopem resort
tujémem cemetery
tatem shrine
zúm zone
ubem destination
ibem origin
pum destination
pim starting point
epem station
ijem starting point
ujem endpoint
tim room, chambermiltim bathroom
éstim bureau
datim salon, living room
zótim hall, corridor
tjujim bedroom
telim dining room
magelim kitchen
tilim bar
zatim lobby
zotim antechamber
áktim waiting room
timet cubicle, cabin, roomette

Places and containers

[edit | edit source]
The "place" suffixes am, (e)m, im, ém, and éb are short for and recall tam house, tem space, tim room, ném box, and céb container.


Buildings (-tam, -am)

[edit | edit source]
t- human-relatedtam house
nun merchandisenunam store
nac moneynacam bank
apelat beeapelatam beehive
pancin cinemapancinam moviehouse
tel foodtelam restaurant
til drinktilam bar
tier to studytitam school
tuer to instructtutam institute
tata holytatam church
dénán book collectiondénánam library
cuzán art collectioncuzánam museum
bekil drugbekilam pharmacy
ep stopepam station
pon restponam hotel
bek treatmentbekam clinic
bok illnessbokam hospital
bik carebikam nursing home
bak healthbakam sanatorium
avol breadavolam bakery
dez showdezam theatre
daz dancedazam dance studio
cefál coffeecefálam café
belud guardbeludam guardhouse
apet horseapetam stable
koer to hidekoam shelter
def paperdefam stationery
túj sleeptújam dormitory
voc flowervocam floristry
par vehicleparam garage
pat birdpatam nest
vab grassvabam grange

Places and spaces (-tem, -em)

[edit | edit source]
t- human-relatedtem hall
ep stopepem stopping point
tij birthtijem birthplace
és workésem factory
ek playekem playground
dropek wardropekem battlefield
koer to hidekoem hideaway
pier to departpiem departure point
puer to arrivepuem arrival point
ab onabem top
ob underobem' bottom
áb upábem upstairs
ób downóbem downstairs
éb betweenébem interstice
éz inézem interior
óz outózem exterior
ib fromibem origin
ub toubem destination
ij startijem starting point
uj endujem endpoint, goal
úb nearúbem vicinity
íb faríbem distance
za beforezam front
zo behindzom back
ze middlezem center
ák waitakem waiting area
úz aroundúzem environment
roundzúm zone
uka emptyukem vacant lot
kua lateralkum side
kua lateralkuem sidelines
kia obliquekiem slope
kes trialkesem proving ground
vab grassvabem prairie
áza flatázem plain
íja openíjem open area
throughzém transit area
acrosszèm crossing/bridge
záa widezám expanse
zóa narrowzóm tight spot
pon restponem rest area
tapek sporttapekem sports arena
ifzíp tourifzípem tourist site
ánup meetingánupem meeting venue
tujém coffintujyemem cemetery
ézmelben burialézmelbem burial ground
tata holytatem shrine
tesbeler to memorializetesbelem memorial (site)
nun merchandisenunem marketplace
hea whichhem where?
háa everyhám everywhere
héa anyhém anywhere
hoa nohom nowhere
hua thishum here
hia thathim there
gea samegem the same place
teler to eattelem refectory
ób underóbtem cellar
úja openújtem court
ága longágtem gallery
áb aboveábtem attic
zaóz front outsidezaóztem front porch
zaéz front insidezaéztem lobby
tier to studytitem study hall
tuer to teachtutem class

Rooms (-tim, -im)

[edit | edit source]
t- human-relatedtim room
tjujer to sleeptjujim bedroom
teler to eatteltim dining room
mageler to cookmagelim kitchen
és workésim bureau
mil watermiltim bathroom
tata holytatim chapel
vi nicevitim salon
ák waitáktim waiting room
za frontzatim lobby
zo backzotim backroom
daer to talkdatim parlor
tapek sporttapektim exercise room
teacibar t.v.teacibarim t.v. den
mover to smokemovim smoking den
ón apartóntim compartment
éz inéztim chamber
zóa narrowzótim corridor/hall
tuer to teachtutim classroom
cim chairbimer to sit
cum bedbumer to lie down

Enclosures (-tém, -ném, -ém) and containers (-céb, -éb, -éf)

[edit | edit source]
t- human-relatedtém residence
aza strongazém safe
koer to hidekoém shelter
pon vacationponém suitcase
mog ashmogém ashtray
óm iceómém ice chest
voc flowervocém flower bed
voc flowervocéb flower pot
il liquid + neer reserveilneéb tank
il liquidiléb bottle
il liquidilcéb carafe
til drinktiléb glass
til drinktilcéb cup
el foodelcéb pot
tol foodtoléb casserole
áz flat+tol consumablesáztoléb pan
telil soupteliléb bowl
ber putbém position
tab bodytabém posture
tes thoughttesbém method
tep mindtebém attitude
eber to stopebém situation
uka emptyukém slot, vacancy
nac moneynacém cashbox
noz jewelnozém jewelry box
n- commercialném box
nac moneynacéf purse
n- commercialnéf bag
néf weavenéfém basket
faof woodfaoféb barrel
mak electricitymakéb battery

Building structures (moc) and furniture (com)

[edit | edit source]
moc floor [stage]amoc ground floor
emoc second floor
imoc third floor
obmoc basement
abmoc penthouse
ébmoc mezzanine
mocpar elevator (also: álbur)
mac wallabmac roof
obmac foundation
ézabmac ceiling
ézobmac floor
uzabmac vault
abzamac balcony
abkumac ledge
macsud mason
mactén masonry (industry)
macán masonry
ózmac outer wall
ézmac inner wall
úzmac fence
mefa mac brick wall
macet fence
ónsmac partition
màc screen
mec doormecag entrance-way
zamec threshold
mic windowmicet ticket window, porthole
micof blinds
micov curtain
abmic sunroof
micog skylight
muc stairsmucnog step
mùc ladder
zúpea muc escalator
mucim stairwell
igózpen muc fire escape
com item of furniturecomber to furnish
comán furniture
comser to make furniture
comsud furniture maker
milcom sink
comiper to move
cam closettelarcam buffet
tofcam clothes closet
déncam bookcase
macam cupboard
comoc shelf
tovcam linen closet
ècam alcove
cem tabledrecem desk
cèm pulpit
cemném drawer
cemof table cloth
cemób table leg
cemet board
úscemet serving tray
tilcem bar
cágcem counter
cemaper to sit down at the table (also: bemer)
cim chaircìm seat
agcim armchair
ágcim couch
ciim bench
ècim stool
tôabcim footstool
cimub arm rest
cimzom seat back
baanetcim rocking chair
zoólbcim recliner
milnef cim bucket seat
cimbier to occupy a seat
cimbuer to seat (someone)
cimober to unseat
cimaper to sit down (also: bimer)
cum bedcuam cushin
cuàm pillow
cuem mattress
cuav bedspread
cuev sheet
cuef cover
cuim box springs
cumnán litter
cumaper to go to bed, lie down (also: bumer)

Food (tol)

[edit | edit source]
tol foodstuffstoler to feed
tola alimentary
tolcéb pot
toléb casserole
áztoléb pan
tolam grocery store, market, tolamud grocer
tolar eating utensil, tolarán dishes
tolnún produce, groceries
tel (prepared) foodteler to eat
otel hunger, otelcer to hunger, otela hungry, otelag famine, oteltujer to starve (to death)
telun edible (item)
vitelyd gourmet
vitelea gourmand
telam restaurant, telamet cafe, telamseb restauranteur
telém buffet
teléb plate, telébar serving tray
telar fork, telarán place setting, cutlery
telim kitchen
telten culinery
telsur cooker
telsud cook
telseb chef
telil soup, teliléb soup bowl
magtelur stove
teleá edible, oteleá inedible
teluz tasteteluzer to taste
tèluz savor, tèluza savory, tèluzer to savor
oteluz disgust
oteluza disgusting
oteluzer to be disgusted
til drinktiler to drink
otil thirst
otilcer to thirst
otila thirsty
otilag draught
tilam bar
tilamag brasserie
tiléb glass
tilcéb bowl
tìlcéb cup
tilar spoon
tilarag soup spoon
tilarog teaspoon
tileá potable, otileá non-potable
omtil refreshment, soft-drink
tul dish, served foodtulán meal
atulán breakfast, atuláner to eat breakfast
etulán lunch, etuláner to lunch
itulán dinner,ituláner to dine
jatul appetizer
jotul dessert
ébtul snack
tuléb platter
tulil soup
tulánag banquet
tuldren menu
tulusud waiter, tulusudán wait staff, tulusdeb head waiter, maitre d' , tulúsnac (restaurant) tip
tuljób mealtime
-ol/ól (solid)taol meat,taolam butcher shop, taolud butcher, taolil stew, úgtaol beef steak, ápetaol sausage, ápetól ham
mimol salt, mimolika salty
vavol salade, greens
avol bread, avolet bread crumb, abavol crust, avolek flour, avolam bakery, avolud baker
ébcavol sandwich
cabavol slice of bread
ázavol pancake, flatbread, pizza
úzavol wrap, burrito
góavol crepe
leavol pastry
leávol cake
aleavol brioche
umleavol cookie
umcavol cracker, biscuit
uzleavol croissant
afleavol fruit pie
taoleavol meatpie
leavolser to make pastry
leavolsud pastrymaker
leavolam patisserie
-el/él/ál (semi-solid)eopel beef, gocra eopel ground beef, gocra eopel ébcavol hamburger
uopel mutton
ápel pork
él oil
kafabél olive oil
gevobél corn oil
magél cooking oil
tàal fat, grease
mageler to cook
magéler to fry
level sugar, levela sweet, leveler to sweeten, lèvel candy, levil syrop, lèvelud confectioner, lèvelam confectionary
elcéb pot
ápel pork, ápelán pork meats, ápelam pork butchery
-il (liquid)iléb bottle
tuil sauce
tulil soup
vafil wine
ígvafil vinegar
afil cider
ávil beer
levafil liqueur
bil milk, bilam dairy, bilíg cheese, bilúg butter
bilúgl yoghurt
abil cream
fáblevil compote
fábil fruit juice
taobil gravy, jus
levil syrup
apelatil honey
mag-mageler to cook, magelur cooker
magiler to boil, magilur boiler
màgiler to broil, màgilur broiler
magler to roast, maglúr roaster
abmagler to grill, abmaglur grill
magéler to fry, magélur frier
magoler to bake, magolur oven
magler to roast, maglur roaster
magtelur stove
magsur burner
gopar knife 

Time (job)

[edit | edit source]
job timejoba temporal
ponjob vacation
ógjob short while, ógjoba temporary
ívjob leasure
ágjob longtime, ágjoba chronic
jejoba chronic
zé job over time
ádjob eternity, ádjoba eternal
gonjoba part-time
jobúgc delay, jobúgser to delay, jobúgca delayed
jobigc haste, jobigcer to hurry
kóca (jonabca) jobem appointment
jobnabs schedule
jobdaf schedule
joob periodjoòb era, epoch
joobag eon
joobog short period
jooba periodic
jooban periodicity
joobà periodically
odjobu? when?
udjobu now
idjobu then
ádjobu always
ódjobu never
édjobu whenever
gedjobu at the same time
ogedjobu some other time
údjobu sometime
jab yearjaba annual
cojab century, cojaba secular
jabij new year
jabuj year's end
jabdén yearbook
jabzòp anniversary
jeb seasonjeba seasonal
jeab spring
jeeb summer
jeib autumn
jeub winter
jib monthjiba monthly
ijib trimester
ájib semester
jiab January
jieb February
jiib March
jiub April
jiób May
jiáb June
jiéb July
jiíb August
jiáb September
jilob October
jilab November
jileb December
jub dayjuba daily
éjub week, éjuba weekly
juab Monday
jueb Tuesday
juib Wednesday
juub Thursday
juób Friday
juáb Saturday
juéb Sunday
ponjub holiday
ívjub day off
ádjubu every day, ádjuba daily
jubdén diary
jubdrén newspaper, jubdréna journalistic, jubdrénud journalist
zojub yesterday
udjub today
zajub tomorrow
ivjub feast, ivjuber to feast, ivjuber to celebrate
tijub birthday
agtijub Christmas
zòtujub Easter
jób hourjóba hourly
jóbar clock
tíjóbar alarm clock
tubjóbar wrist watch
jóbándaf schedule
jáb minutejâb moment, jâba momentary
jéb secondjêb instant, jêba instantaneous
maj daytimemaja diurnal
ijmaj dawn
imaj morning
ujmaj dusk
umaj evening
èmaj noon
joèmaj afternoon
fimaj good day!
fiumaj good evening!
ádmaju every morningudmaju this morningzomaju yesterday morningzomaju tomorrow morning
moj nightmoja nocturnal
èmoj midnight
fimoj good night!
ádmoju every night
udmoju tonight
jud datejudrer to date
jojudrer to postdate
jajudrer to antedate
judar calendar
judaf calendar
judén datebook
odjudu on what date
udjudu on this dateidjudu on that date
jàg agejaga old, jagat elder, jagan old age, jagat bikam elder care facility, jagcer to age, jagca aged, ágcea ageing
joga young/new, jogan youth (state), jogat youth (person), jogatán youth (coll.), egjogser to rejuvenate/renew, joganéna youthful
gajàga elder
gojàga younger
gejàga of the same age, as old (as)
jéga adult
jega middle aged
jòga adolescent
ojéga minor
gájàga eldest
gójàga youngest
glajàga antique, ancient
glojàga brand new, very young
odjàg how old?


Time expressions

[edit | edit source]
expressionexample
ja beforeYujo mani ja et pio. Turn out the lights before you leave.
je whileTobob tuja je tújá. The child died while sleeping.
jo afterJo teacera mavi it igípa. After seeing the flames, he fled.
ji sinceAita tijé ga fià ji dropek úja. We have been living better since the war ended.
ju untilJu et agco, et ho tido. Until you grow up, you won't understand.
earlyGa já ga fi. The earlier the better.
on timeValco puer jé. Be sure to arrive on time.
lateHo puo já! Don't arrive late!
zojubu yesterdayHè mamila zojubu? Did it rain yesterday?
udjubu todayIyt deuzo udjubu. She is going to sing today.
zajubu tomorrowAt ikso dén zajubu. I will finish the book tomorrow.
zomoju last nightHè et fi túja zomoju? Did you sleep well last night?
udmoju tonightUdmoju ho eco màri mamu. Tonight there will be no stars in the sky.
zamoju tomorrow nightTijuba vitul aco zamoju. The birthday feast will occur tomorrow night.
jazojubu the day before yesterdayVab gorfàa jazojubu. The grass had been mowed the day before yesterday.
jozajubu the day after tomorrowAvolam íjco jozajubu. The bakery will open the day after tomorrow.
alreadyUvà eta ted jà pia. Sadly, your father has already left.
gaj stillHè pati gaj tijea? Are the birds still alive?
yetHè et jù teuca hia pancin? Have you seen this movie yet?
aju in the pastUti sá hubén aju. People used to act that way in the past.
eju at presentEju ait ukce mil. At present, we are out of water.
oju in the futureEt fi to oju. You'll know better in the future.
ji idjob since then, thenceforthJi idjob eca hoga sejeti. Since then, there have been no further incidents.
jo udjob from now on, henceforthJo udjob at éso ga tepazà. From now on I will work more diligently.
ju idjob until thenJu idjob at ho teacàa ídcuni. Until then, I had not seen such things.
ju udjob until now, up to now, so farHot ózpa ju udjob. Nobody has emerged so far.
iju firstAt vagó iju ivader et av updier at. I would first like to thank you for inviting me.
nextJò ait teeco drez Sekspira. Next we shall hear a poem by Shakespeare.
uju finallyElánidpar uju pua. The train has finally arrived.
gloja recentlyIit gloja tadca. They recently married.
glojo soonJobipar co him glojo. The taxi will be here soon.
glaja a long time agoHua pancin ózpa glaja. That movie came out a long time ago.
glajo a long time henceDropek ujco glajo. The war will come to an end a long time from now.
gója justAt gója ijeaca eta vóon. I just now noticed your error.
úbji justAt úbji ijeaca eta vóon. I just now noticed your error.
úbju almostAt úbju aka. I almost won.
ja agoKeus aca ja e jub. The accident occurred two days ago.
glaj for a long timeAt ésa hum glaj. I worked there for a long time.
gloj for a short timeAt ésa him anà gloj. I worked here only for a short time.
ókbénà suddenly, all of a suddenYokbénà teuzibar ceusa. Suddenly the phone rang.
igjobu suddenly, all of a suddenIgjobu teuzibar ceusa. Suddenly the phone rang.
odjobu? when?Odjobu et sa uda cizun? When did you do this painting?
adjobu when (relative)At sa cizun adjobu at ca joga. I did the painting when I was young.
ji odjob? since when? for how long?Ji objob et ce tadca? How long have you been married?
ju odjob until when?, how longJu odjob et drecéo eta dén? How long will you be writing your book?
idjubu then, at that timeEt ca via idjubu. You were beautiful then.
udjubu now, at this timeAt ése ge tuut udjubu. I work as a teacher now.
ádjubu always, all the timeIyt ádjubu teubòze. She always smiles.
údjubu sometimeIyt egteapo údjubu. She'll visit again someday.
ódjubu neverAta épet ódjubu épede. My dog never barks.
ju ádjub foreverIit áke beer tadca ju ádjub. They hope to remain married forever.
édjubu ever, anytimeEt vege teaper édjubu et vage. You can visit anytime you like.
údjubu sometimeAt teapo et údjubu úboju. I will visit you sometime in the near future.
ogedjubu some other timeEt égo uper ogedjubu. You'll have to come some other time.
ídjubu at such a timeAit ége doer ídjubu. We must be silent at such a time.
gedjubu at the same timeYad e nidpari pua gedjubu. Both trains arrived at the same time.
vo...gaj no longer, anymoreAt vo vage gaj teacer et. I don't want to see you any longer.
odjopi? how often?Odjopi et pe pancinu? How often to you go to the movies? (jop instance in time)
ajop onceEt ége utmilabaner ajop jubè. You must bathe once a day.
ejopi twiceAt vísa par ejopi. I washed the car twice.
glajopi oftenAit deuze ánà glajop. We often sing together.
glojopi seldomAt glojopi teaca ídcun. Seldom have I seen such a thing.
gaijopi sometimes, at timesIyt ceace geijopi jó. She sometimes shows up late.
ojop neverAt ojop vóde. I never lie.
ídjop so oftenEt ídjop abdabe ébdaen. You dominate the conversion so often.
gejopi as oftenUpo gejopi vé et vage. Come as often as you like.
gajopi more oftenAta ted datupe gajopi vé ja. My father visits more often than before. ( than)
gojopi less oftenAt zípe gojopi udjubi. I travel less often these days.
géjopi quite oftenNun ce géjopi nasaga. The merchandise is quite often expensive.
grajopi too oftenEt tile grajopi. You drink too often.
grojopi too infrequentlyAt ózpe tam grajopi. I get out of the house too infrequently.
gájopi as often as possibleEt ége milaber voci gájopi. You should water the flowers as often as possible.
gójopi as seldom as possibleAt ázte maru gójopi. I lie in the sun as seldom as possible.

Beginning and ending (ijer, ujer)

[edit | edit source]
The following table shows j (time) words that forms parallels on the basis of the iu ordinal vowel opposition:
ijer to beginujer to end
ij beginninguj end
ija initialuja final
tijer to be borntujer to die
tij birthtuj death
tija natal, borntuja mortal, dead
tijser to birthtujser to kill
majij dawnmajuj dusk
tobij ovum 
vabij seed 
patij egg 
magijer to sparkmagujer to extinguish
manijer to lightmanujer to turn off
esijer to set in motionesuj to terminate
tesij idea 
jabij new year'sjabuj year's end
íjer to openújer to close
íj openingúj close
íja openúja closed
íjar keyújar lock
íjem passagewayújem dead end
íjofer to unfoldújofer to fold
íjden introductionújden conclusion
tíjer to waketújer to sleep
tíj wakefulnesstúj sleep
tíja awaketúja asleep


aj pastaju in the past, thenajer to delaytaj former lifeja before early
ej presenteju at present, nowejer to waittej lifeje during on time
oj futureoju in the futureojer to preempttoj afterlifejo after late
ij beginningiju in the beginning, at firstijer to begintij birthji since 
uj enduju in the end, at lastujer to endtuj deathju until 

Natural phenomena (mor, mar, etc.)

[edit | edit source]
mor universemora universal,
mòr cosmosmòra cosmic, mòrtun cosmology
mar sunmara solar, marnad sun ray
màr starmàra stellar, màrán constellation, màránag galaxy, màrtun astronomy
mer planetmear Mercury
meer Venus
meir Earth
meur Mars
meór Jupiter
meár Saturn
meér Uranus
meír Pluto
mir worldmira global
amir north, amira nordic
omir south, omira southern
imir east, imira oriental
umir west, umira occidental
emir equator, emira equatorial
mur moonmura lunar
mùr satellite
muar comet
muer meteor
muerog meteorite
mol naturemola natural, omola artificial
mul mattermula material, multun physics
mulet particle
amul atom
amulán molecule
amulet atomic particle
amula atomic, amulzem nucleus, amulzema nuclear
emul electron
imul proton
umul neutron
umulet neutrino
ámul quark
mal airmala aerial
màl gas
maal atmosphere
mael troposphere
mail stratosphere
maul ionosphere
maól exosphere
malp airwave
mam skymama celestial, mamnad horizon, mamèzún rainbow, mamceus thunder
mamevan weather
mamevantun meteorology
maem spacemaema spatial, paem spacecraft, maempopud astronaut
map windmaap gust
maep breeze
maip puff
mapag cyclone
mapaget storm
maper to blow
maiper to puff
maf cloudmaaf stratus
maef nimbostratus
maif cumulus
mauf cumulonimbus
maóf stratocumulus
màaf allocumulus
maéf allostratus
maíf cirrocumulus
maúf cirrostratus
malof cirrus
óbmaf nimbus
mafàa cloudy
mafòa cloudless
mel ground, earthmela terrestrial, meltun geography
ánmel continent, ánmela continental
ónmel island, ónmela insular
mem countrymeam region
meem land
meim countryside
memcin scenery
memud peasant
ázmem plain
ázmeam valley
ázmeem dale
ukmem desert
ènukmem steppe
vabem prairie
vabemet meadow
ébmem isthmus
ézmelber to bury
mep waymèp route
meap road
meep path
meip lane, track
meup pass
mepet alley
uzmep detour
izmep bee-line
kumep sidewalk
domep highway
óbmep subway
meb mountain
mebán mountain chain
ázmeb plateau
miekmeb dune
magmeb volcano, magmeba volcanic, magmebil lava
mèb mount
meab hill
meabet hillock
met gardenzamet front yard, zomet back yard, kumet side yard, vocmet flower garden
med parkpotmed zoo, fabmed arboretum, pemed parking lot
mom undergroundmoma subterranean
mompar subway
momesem mine, momesud miner
mob precipicemòb abyss
moab canyon
moeb ravine
moib cave
moub ditch
mop tunnel 
mim seamima marine
mimag ocean
miam lake
miem pond
miim marsh
mióm swamp
ézmim bay
midom port
mimkum shore
mimázkum beach
mimuzkum gulf
ébmim strait
mimpop ocean cruise
mimbok seasickness
mimanar lighthouse
mit basin 
mip rivermipa fluvial, miper to flow, run
miap river
miep stream
miip brook
mipet tributary
igmip torrent, igmipa torrential
ébmip canal
mipkum riverbank
mimzèmep bridge
mipugar dam
mipàa riparian
mil watermila aquatic
óbmila underwater
mamil rain
mamiler to rain
mileter to drip, milet drop, miletog droplet, mileteá drippy
umilóbiner to drown [intr.]
milpóer to drown [intr.]
miltujer to drown, miltujat drowning victim, miltuj drowning
milper to swim
milber to water, irrigate
milpón waterfall
milabaner to wash [tr.], utmilabaner to bathe, milaban bath, milabanim bathroom, milabanam bathhouse, milabaném bathtub
miltim bath, washroom
milcom sink
ilper to flow, ilp flux, current
iligper to gush, stream
ilaper to float, ilapar flotation device
ilukser to flush, iluksar toilet
ilikser to flood, iliks inundation
gámiluper to flood, gámilup flood
ilóper to downpour
ilzíber to spray
ilpúner to squirt
ilpáner to gush
iloker to leak, ilok leak
ilpéner to splash
tiibiloker to bleed
ilzéper to leak, ilzép leak
ogilzéper to trickle, ogilzép trickle
zoílper to back up with water, zoílp reflux
ilpan wave
ilpanet ripple
ilápóper to undulate, ilápóp undulation, wave action
mimupip tide, mimupipa tidal
mimbin tide, mibina tidal
mimpán surf, mimpánud surfer, mimpán faof surfboard
ilbuner to pump, ilbunar pump
milbiner to pump, draw water, milbinar pump, milbinéc well
ilaber to pour
utmilzíber to take a shower
milbím spring
tilcom drinking fountain
milbíc fountain
mimper to navigate, sail, mimpar ship
mimpoper to sail, travel by sea, mimpop cruise, sea voyage, mimpopud sea voyager, mimpopar cruise ship
ima wetimcer to get wet,imsrer to drench, ìmser to dampen, iman wetness, ìman humidity, olimsar dehumidifier
uma dryuman dryness, umser to dry, umsar dryer, umca dried
ama hotaman heat, amanàg temperature, àma warm, àman warmth, amser to heat, amsar heater
oma coldoman cold, òma cool, omser to cool, omsur refrigerator, òmser to refresh, òmsea refreshing, òmsun refreshment
óm iceóma frozen, ómser to freeze, ómsur freezer
óom frost, óoma frosted, óomcer to frost over, olóomser to defrost, ovóomil antifreeze
man lightmaer to shine
manet glimmer, maneter to glimmer
manser to light up
maníjer to turn on the light
manújer to turn off the light
manager to illuminate
màna clear, mànser to clarify, mànan clarity
lomàna opaque
manig sparkle, maniger to sparkle
kumaner to reflect
zòmaner to mirror, zòmanar mirror
mag firemagar match, magam fireplace
magser to burn, magsar burner
magcer to burn (intr.), magca burned, magcun a burn
mageler to cook, magelud a cook, magelun cuisine, magelar oven, magelur frying pan
magújer to extinguish a fire, magújud fireman, magújam' fire department


magil petroleum
magìl napth
maagil fuel
maegil gasoline
maigil kerosene

mav flamemaver to flame, maveá flammable, mavser to inflame, mavsen inflammation, mavugea flame retardant
mak electricitymaka electrical, makser to electrify, makéna electronic, maktun electronics, makveg electric power, makvegam electric power plant
mov smokemover to smoke, movikca smoke-filled, movet plume
mon darkmona dark, moncer to grow dark, monser to darken (tr.)
otmon shadow, otmonéna shadowy
mòn shade, mòna shady, obscure, mònan obscurity
meg stonemegéna (made of) stone, megàa rocky, megunkum cinder block
megag boulder
megog pebble
meag marble
meeg slate
meig granite
meug clay
meóg clay
meág chalk
meég limestone
meíg alabaster
meúg rubble stone
mealog sandstone
megóg gravel
mieg pebble
mameg coal
maameg anthracite
èmameg coke
maemeg peat
maimeg lignite
mek dustmék powder
méik paste
mékar mill
mékam mill
meil mud
mef brickabmef tile
mev porcelaine 
mez gemstoneamez diamond
emez topaze
imez ruby
ómez sapphire
ámez amethyste
vamez emerald
mezán jewelry, mezánam jewelry shop

Money (nac)

[edit | edit source]
naz valuenazer to be worth, nazika valuable, nazuka worthless, nazder to evaluate, nazter to esteem, utnaz merit, utnazer to deserve, utnazika meritorious, onazteá inestimable, nazta esteemed
nas pricenasaga expensive, nasoga cheap, nasán rates, nasuka priceless
nàs cost, nàser to cost, nàsaga costly, nàsòa cost-free, nàsán costs, nàsder to cost out
nac moneynacet change, nacetéb coin purse, nacdref check, jonacdref bill, nacán capital, ánac funds, ánàc sum, nactun finance, donactun economy, nacam bank, nacika rich, nacuka poor, úsnac gratuity, tip, nasak profit, nacok loss, gornacdren stock, gornacdrenam stock market, yebkyanac commission, nacyeg debt, nacyegaya indebted, nacyeger to owe money
noc expensenocer to spend, nòc fee, funoc waste, finoca generous
nec savingsnecer to save, necán savings, cágdin necána savings account, funeca stingy, nècer to economize
nuc paymentnucer to pay out, nucbier to buy, nucbiud buyer, nucbiudán clientele, dobnuc tax, nucvegeá solvable, jobnuc credit, jobnucud creditor, jobnucdaf credit card, januc prepayment, zònucer to reimburse
nic incomenicer to collect, cash, nicán revenue, nicbuer to pay for, nicbuud vendor, ésnic salary, ésnìc wage, tutnic honorarium, égnicag tribute, dobnic pension, dotnic allowance, donic annuity, ésnicud wage earner, jonic debit, jonicud debitor, jonicdaf debit card, zònicer to recover

Merchandise (nun) and materials (nof)

[edit | edit source]
nun merchandisenunam store, nunàm boutique, nunamet shop, nunamán shopping center, nunem market, nunud merchant, nunébkán commerce, nundel advertisement, nunemtun marketing, nuler to acquit,
noz jewelnozud jeweler, nozam jewelry shop, nozán jewelry, nozika bejeweled, tuóz bracelet, obtez necklace, tuúz ring, tiaz broche, teez earring, tez crown, teiz nose ring, nozkobilud jewel thief
nof materialnofser to weave, nofsar loom, nofán textiles
tof clothestaf suit
tif vest, etc.
nov linennòv sheet
novet rag
milnov towel
milnovet handtowel
milov wash cloth
naf clothnaaf drape/curtain, naafán drapery
naef canvas
naif velvet
nauf net
nef knit, yarnnefser to knit, yarn
neef lace
nif thread, wirenifser to thread, wire
nìf string
nifet filament
nifar needle
nivar pin, ánifer to sew, ánifur sewing machine, ániftén couture, nifòa wireless, maknif electrical cord
náf knotnáfser to knot
níf cordnífet lace
nífetog braid
néf sack, bagném box, némag case, poném suitcase, áznéfem basket
nóf filmnóv ribbon
núf buttonnúfec buttonhole (zéc hole)
fuf pipefùf tube
tilfuf drinking straw
tiibuf artery (fub branch)
zúf postzúfet column, pimzúf mast, zézúf cross-beam
zúv stickzúvet cane, ágzúv pole
faof boardfaocéb barrel (fab tree + nof material + céb container)
mez crystalmeg stone + naz value
zéf glasszév glass
cinzéf mirror, cimzéf window pane (zéteaser see through + nof material)
utaéf woolupet sheep
apeéf silkapeét worm
favof cottonfavob cotton plant
fivof hempfivob hemp plant
fuvof jutefuvob jute plant
favov cotton woolfavob cotton plant
taóf leathertaób skin + nof material
taéz furtaéb hair + naz value

Measures and dimensions (nag)

[edit | edit source]
nog degreeanoga primary
enoga secondary
inoga tertiary
unoga quaternary
henoga to what degree, how?
nogper to step, zànogper to advance, progress, step ahead, zònogper to step back, regress, ábnogper to step up, be promoted, advance, óbnogper to step down, be demoted, nogà by degrees
nòg grade, step, nogéna gradual, ujnògper to graduate, ujnògpud graduate
noog stage, level, status, enooga bi-level, two-staged, ábnooga high-status, dotnoog social status, class, óbdotnooga low-class, kódotnoog caste
nag dimensionanaga one-dimensional
enaga two-dimensional
inaga three-dimensional
glanaga multi-dimensional
nàg measure, size, nàger to measure, genàga commensurate, onnàgeá immeasurable, zenayga moderate, ozenayga immoderate, zenaygaser to moderate, naygar meter (measuring device), nayga metric, naygpar taxi
neg levelgenega even, ogenega uneven, odd, glanega multiplanar, negar level (planing device), enega bi-level, ébnega interplanar
nég spacenéga spatial, onég void, glanéga spacious, ónanég interval, ónanégser to space out, tomnég Lebensraum, cf. néb container
nib row, ranknibser to arrange, nibcer to adapt, niber to array, oniber to disarray, óniber to topple, nibémer to dispose, ábniba high-ranking
nip order, turn, sequence, queuenipber to order, onip disorder, onipber to mess up, nipba ordered, orderly, neat, sequential, onipba out of sequence, out of order, messed up, Heta nip ce? Whose turn is it?, jonipa next, janipa prior, niper to queue up, to line up, to get in order, zínipber to sort, vánip proper order, order
nud columnnuda columnar, nibnubi coordinates, nibnubcan grid, matrix, row-column format
nod pointzenod mid-point, center, zénod hub, intersection, ábnod high-point, climax, apex, óbnod low-point, nadir, ijnod starting point, ujnod endpoint, butt, terminal, drenod period, dot
ned surface, plane, faceneda superficial, planar, záned stretch
nedet facet, glaneda multifaceted
nid line
(cf. nif wire)
nida linear,

teacnid light of sight, nidber to align, obnider to underline, nidar ruler, elánid rail, jopnid track, kunid edge, border, rim, zyunid circumference, boundary, zyeiznid perpendicular (line), zyeiznida perpendicular, mamnid horizon, yaztanida horizontal, yabtanida vertical, kinid diagonal, zeynid transversal, kinida diagonal, zenid midline, nidcer to line up, queue up, form a line, iznid' straight line, geizana nid parallel line, ébnida interlinear, drenid line of text, zanid front-line, frontier, forward line, óznid limit, íbnid limit
nìd ray, radius, nìdcer to radiate, marnìd sun ray, nìda radial
niid trait

néd volume
(cf. néb container)
nédàa voluminous, zúnéd sphere
gekumnéd cube
cag numbercaga numeric, cager to number, cág count, cáger to count, cáag calculation, cágar computer, cáagar calculator, cágud accountant, cágán account
nan time (frequency)anan one time
enan twice
glanan often, glanana frequent
glonan seldom
henan how often?


Geometry

[edit | edit source]
kín weight 
azan strength 
igan velocity 
íban distance 
izan direction 
ágan length 
záan width 
óban depth 
ában height 
zúan girth 
bar pressure 
kítan gravity 
gáan thickness 
ígan solidity 
zeban density 
maan brightness 
nangan frequencyegan repetition, nan time(s)
jag age 
voz color 
gan quantity 
fin quality 
cág numbermeaning count; number is cag
nog degree 
nébgan volumenég volume, meaning a solid
végan ratio 
nas cost 
naz value 
zènidgan diameteras a line: zènid
zúnidgan circumference 
ènzègan radiusas a line: nìd
nag dimension 
neg level 
nib row 
nip orderalso: turn, sequence
nub column(on a grid)
can shape 
néd volume, solidzúnéd sphere, gekumnéd cube, zúfnéd cylinder, defábnéd cone, aginéd cone
nid linekunid border, zúnid contour, zénid transverse, zéiznid perpendicular, kinid diagonal, áztanid horizontal, ábtanid vertical, zenid midline, iznid vector, uznid curve, curved line, geizana nid parallel
gun anglegegun right angle, gagun obtuse angle, gogun sharp angle, igun triangle, ugegun rectangle, uogegun rhomboid
nod pointzenod midpoint, zúnod turning point, zénod intersection
kum sideágkum hypotenuse, abkum topside, obkum bottom, gekuma equilateral, ekuma bilateral, glakuma multilateral, ugekum square
ned planeeneda biplane, glaneda multifaceted
zúc circleèzúc semi-circle, zûc oval
zúfuf cylinder 
gin tip, pointaginéd cone

Instruments and Machines (-ar, -ir, -ur)

[edit | edit source]
The -ar suffix is used for instruments and devices in general. The -ir suffix is used for machines, while -ur is used for motors and engines. The distinction is only made when necessary.

Vehicles (par)

[edit | edit source]
zíp travelzíper to travel, zíptam hotel, zípem travel destination, zìpud traveler,ifzíp tourism, ifzípud tourist, zípdren passport, zípmep itinerary, zípém suitcase or zípa ném suitcase
par vehiclepara vehicular, parupip traffic, parzíp traffic, pareper to park,parepam garage, parepem parking lot
nunpar truck
éspar truck
nunparet van
makabnifpar tram(electrified overhead wire car)
binifpar trolley, cable car (pulled cable car)
elánaadpar train (iron rail car), elánaadpar epam railway station
naadpar train
ágpar train
gorsémpar train (compartmented vehicle)
dompar bus (city vehicle), dompar epam bus station, bus stop dompar epem
tánpar bus (people vehicle)
zípar bus (roundabout vehicle)
ébdompar motorcoach (intercity vehicle)
paret cart, wagon
curezúcpar motorcycle, parizber to drive/pilot, parizbud driver/pilot, parizbuda vegdren driver's license, pilot's license
jobnucpar taxi, cab
mamp flightmamper to fly, mampud aviator, mampen aviation
mampar airplanemamparam hangar, mamparem airport, mamparet small plane, memparag jumbo jet, zípuda mampar passenger plane, nunkína mampar cargo plane, dropeka mampar warplane, zúptuba mampar helicopter ("rotating wing plane")
memp ridememper to ride
mempar carmemparam carport, garage, meparem parking lot, nàga mempar taxi
mimp sea voyagemimper to sail, mimpena maritime
mimpar shipmimparem marina, mimparof sail, óbmimpar submarine, mimparud mariner, mimpartim ship cabin, mimzíp cruise, mimpareb ship captain, nunmimpar cargo ship
maimpar hydroplane 
meampar funicular 
mompar subwaymomparem subway station, mompar zémep subway tunnel

Tools

[edit | edit source]
c- objectcar tool
carán toolset
tuábcar handtool
éscar work tool
carném toolbox
egcarser to retool, repair
egcarsud repair technician
c- objectcàr instrument
càrán instrumentation
càréna instrumental
càrcer to be instrumental
c- objectcur device
curán equipment
curbàser to equip
dopcurán ordnance
c- objectcúr apparatus, system
cúra systemic
cúraser to systematize
c- objectcir machine
cirán machinery
cira mechanical
cirud mechanic
ciraser to mechanize
c- objectcír motor, engine
círàa motorized
círàser to motorize
c- objectcìr mecanism 
p- gopar vehicle, car
para vehicular
parupip traffic
parepam garage
parepem parking lot
círpar motor vehicle
círezúcpar motorcycle (also: círezúc motorbike)
goper to cutgopar knife
goparer to stab
ígfagoper to sawígfagopar saw
gofer to sheargofar scissors, shears
grorber to shavegrorbar shaver, razor
úzbaler to pinchúzbalar pliers
úzbalaret tweezers
zúfod screwzúfodar screwdriver
apéner to hitapénar hammer
apénarer to hammer
mamil rainovmamilar umbrella
póner to fallovpónar parachute
mar sunovmarar parasol
biner to pullbinar handle
mobser to digmobsar excavator
uklan hollowuklar shovel
zéc holezécbar bore
nofázer to ironnofázar iron
nofázenfaof ironing board
aman heatamsar heater
oman coldomsar refrigerator
óm iceómsar freezer
ánifer to sewánifur sewing machine
nif threadnifar needle
nivar pin
mék powdermékar mill, grinder
taéb hairtaébar comb
taébarer to comb
vícer to cleanvícar brush, sweep
'vícarer to brush, sweep
albaner to wipealbanar mop
albanarer to mop
álber to liftálbur elevator
teler to eattelar fork
tiler to drinktilar spoon
iber to receiveibar receiver
uber to sendubar transmitter
íjer to openíjar key, opener
azújer to lockazújar lock
céb containercébíjar opener (for cans, bottles, etc.)
dopa militarydopar weapon
doapar gun


dopur rifle
igdopur machine-gun
dopir canon
doapir bazooka

mageler to cookmagelar cooker
magiler to boilmagilar boiler
magler to roastmaglar roaster, oven
abmagler to grillabmaglar grill
tel food + éber to holdtelébar platter
telarán dishestelarán milbar dishwasher
il liquid + újer to closeilújar faucet
mip river + ugser to brakemipugsar dam
mil water + ukser to flushmiluksar toilet
drer to writedrar pen
drear pencil
uga slowugsar brake
úgcra elasticúgcrar spring
eker to playekar toy
cág countcágar calculator
cágir computer
mancin photomancinar camera
panmancin moviepanmancinar movie camera
ceus soundceusdrar recorder
ceus sound + iber to receiveceusibar radio
cin image + iber to receivecinibar television
teuz voice + iber to receiveteuzibar telephone
mak electricity + cyefet cellmakcéfet teuzibar cellphone
nif wireonifa teuzibar wireless phone
pan motionpaneá teuzibar mobile phone
tuúb finger + drer writetuúdrar keyboard, typewriter
tun datum + káls conversionébtunkálsar modem


Animals (pot)

[edit | edit source]
All animal terms contain the notions of mobile (p) and organism (t).

Summary

[edit | edit source]
potanimal (in general)
pótwild beast
patbird
petanimal (land)
pétreptile
peltinsect
pitfish

Domesticated animals (pet)

[edit | edit source]
male female child home noise other
pot animal pòt female animal potob baby animal potmet zoo poder to make an animal noise potun zoology


potuna zoological
potmet zoo
potuj hunt, potujud hunter, potujer tohunt
potaéb mane
poteub muzzle
poteib snout
potub paw
potuúb claw
tiúb tail
teúb horn
tampot pet, poténa animalistic, potán animalia, potan animality

apet horse apèt mare apetob foal apetam stable apeder to neigh apeta equine

apetapen equitation
apetigpek horse race
apetigpekam hippodrome
aopet gelding

epet bullepèt cowepetob calfepetam bull penepeder to snort, epèder to mooepeta bovine
eapet buffalo
eopel beef
ipet assipèt she-assipetob donkey ipeder to bray, hehawiapet mule
upet ramupèt eweupetob lamb upeder to bleatuopet sheep, uopetbelud shepherd
utaef wool
íopel mutton
ópet goatópèt nanny-goatópetob kid  ópetbelud goatherder
ótaéf goat's hair
ápet hogápèt sowápetob pigletápetam pigpenápeder to squealápeta porcine
ápetôafud pig's foot
ápel pork
ápetól ham
ápetaol sausage
épet dogépèt bitchépetob pupépetam doghouseépeder to barképeta canine, êpetob puppy
ípet catípèt she-catípetob kittenípetam cathouseípeder to meow, îpeder to purrípeta feline, ípetobán litter
úpet rabbitúpèt doe rabbitípetob baby rabbitúpetam rabbit cage úpetôafud rabbit's foot
úlpet hare
tapet monkeytapèt female monkey  tapeder to make monkey noisestaapet chimpanzee, tapetag ape
gapet elephant gapetob elephant cub  gapeit hippopotamus
gepet rhinoceros     
vapet stag, hartvapèt doe, hindvapetob fawn   
vepet deer     
vipet roebuck     
vupet chamois     
vópet llama     
vápet antilope     
vépet gazelle     
vípet elk, moose     
fapet camelfapèt she-camel    
fepet dromadery     
kapet squirrel     
kepet polecat     
kipet badger     
kupet otter     
kópet weasel, stone marten     
kápet beaver     
képet ermine, stoat     
sapet hedgehog     
sepet porcupine     
sipet mole     
zapet tortoise    zapeit turtle
zataób turtle shell
klapet rat klapetob baby ratklapetam rat's nest  
klepet mouse klepetob young mouse klapeder to squeekklepetar mouse (computer device)

Wild animals ( pyot )

[edit | edit source]
malefemalechildhomenoiseother
ápót boar     
rapót lionrapôt lionessrapótob lion cubrapótam lion's denrapóder to roar 
repót tigerrepôt tigressrepótob tiger cubrepótam tiger's denrepóder to growl 
ripót leopardripôt female leopardripótob leopard dub  riapót panther
riepót jaguar
riipót puma
riupót lynx
rupót wolfrupôt she-wolfrupótob wolf cubrupótam wolf's lairrupóder to howlrupóta lupine
rópót foxrópôt vixenrópótob fox cubrópótam foxhole  
gápót hyenagâpót she-hyenagápótob baby byena gápóder to laugh like a hyenagáapót jackal
tapót orang-utang     
tepót bear tepótob bear cubtepótam bear cavetepóder to growl (like a bear) 

Reptiles (pyet) and amphibians (pyeit)

[edit | edit source]
malefemalechildhomenoiseother
pyet reptile    pyeta reptilian
gapyet crocodile    gaypyet alligator
gepyet cayman     
kepyet lizard     
lopyet snake   lopyeder to hisslopyeper to slither
lapyet boa     
lepyet cobra     
lipyet viper  lipyetam viper's nest  
sipet mole     
apyeat bat  apyeatam bat's cave  
epyeat vampire     
fapyet grass snake     
fepyet slug     
fipyet leech     
vapyet snail    vapyel escargot
vapyetigyena sluggish, at a snail's pace, vapyeper to move at a snail's pace
apyeit toad  apyeitam toadstool  
epyeit frog    epyeiper to leapfrog
ipyeit tree frog     

Insects (pelt)

[edit | edit source]
malefemalechildhomenoiseother
pelt insect    peltán swarm, ovpeltil insecticide, peltujsil insecticide, pelteleat insectivore, pelper to crawl around
kopelt vermine     
kapelt louse    kapeltika lousy
kepelt flea    ovkepeltof flea collar, kepeltika flea-bitten
kipelt bug    ovkipeltil bug spray
apelat bee  apelatam beehiveapelader to buzzapelatil honey, apelatél wax, apelatán swarm of bees
epelat wasp  epelatam wasp's nest  
ipelat horsefly     
upelat fly    ovupelatar fly-swatter
ópelat mosquito    ovópelanef mosquito net
lapelat maybug     
lepelat beetle     
tapelat cicada   tapelader to chirp 
gapelat butterfly    ápelaper to flit about
fapelt ant  fapeltam anthill fapeltán swarm of ants
peét worm    peétéc wormhole
apeát silkworm     

Birds (pat)

[edit | edit source]
malefemalechildhomenoiseother
pat bird  patam bird's nestpader to chirppatijob egg, patijser to hatch, patper to fly, patpier to fly off, pateub beak, patub wing, pataéb feather, patulob claw, patésun aviculture, patém farmyard, patán poultry
apat rooster, cockapàt henapatob chickapatam chicken coopapader to crowapàtog chicken
epat duck, drakeepàt henepatob duckling epader to quackepatob duckling
ipat turkeyipàt turkey hen  ipader to gobble
upat goose    upatijob goose-egg
ópat guinea-fowl     
ápat pigeonápàt dove ápatam pigeon houseápader to coo 
rapat eagle rapatob eaglet   
repat vulture     
ripat kite     
rupat buzzard     
rópat hawk     
rápat falcon    rápatud falconer
fapat raven     
fepat crow     
fipat' magpie     
gapat ostrich     
gepat peacock     
dapat stork     
dapait heron     
depat marabou     
depait crane     
zapat swallow     
zepat martinet     
tapat parrot   tapader to parrot 
tepat budgie     
vapat nightingale     
vepat yellow canary     
'vipat canary     
vupat chaffinch     
vápat robin     
fapat thrush     
fepat warbler   fepader to warble, yodel 
fipat sparrow     
sapat partridge     
sepat quail     
sipat woodcock     
supat lark     
sópat pheasant     
sápat grouse     
lapait swan     
apait cormorant     
epait gull     
gapait penguin    gapaiper to strut like a penguin

Fish (pit)

[edit | edit source]
pit fishpitán school of fish, pitub fin, pitaéb scale, pitésun pisciculture, pitun ichthyology, pitut ichthyologist, pitpin fishing, pitpinud fisherman
rapit shark 
repit dolphin 
ripit sperm whale 
rupit walrus 
rópit porpoise 
rápit swordfish 
répit tuna 
rípit sturgeon 
rúpit cod 
lapit ray 
lepit turbot 
lipit salmon 
lupit sole 
capit herring 
cepit barbel 
cipit anchovie 
cupit gilt-head 
apit sardine 
epit perch 
ipit pike 
upit carp 
ópit tench 
ápit gudgeon 
épit stickleback 
ípit marline 
gapit whale 
vapit eel 
apiet seal 
epiet sea-lion 

Crustaceans (piit)

[edit | edit source]
piit shellfish 
apiit lobster 
epiit crayfish 
ipiit prawn 
upiit crawfish 
ópiit prawn 
ápiit shrimpápiitpin shrimping
lapiit crablapiitpin crabbing
apiét oysterpiétaób shell, piéz pearl, piètésun ostreiculture
epiét mussle 
ipiét clamipiétpinud clamdigger

Vegetation (fob)

[edit | edit source]

Summary

[edit | edit source]
fobvegetation
fabtree
fábfruit
vobplant
vollegume
vocflower
vozcolor
vabgrass

Trees and fruits

[edit | edit source]
fob vegetationfobtun botany, fobtut botanist, fobéstun agronomy, fobésun agriculture, fobésuna agricultural, fobésud farmer, fobésem farm
fab treefàb shrub, fàbet bush, fàbán shrubery, fabán forest, fabánésun forestry, fabánésud forester, fabánàca forested, fabánet woods, fabánog grove, copse, fàbánet scrub, fàbán thicket, fabmed orchard
fib trunk 
fub branch, limbfubet twig
faéb leaffaébán foliage, faébet bud
fáb fruitfábéna fruity, fábél jam, fâbél jelly, marmalade, fábóm sherbet, fábtul fruit cocktail, fábzeb pit (of fruit), fâob peel
fób rootradicule, fóbober to deracinate
faob woodfaoba wooden
faab sap 
faób bark 
afab apple treeafáb apple, afabet boxer tree
efab pear treeefáb pear, efabet spindle-tree
ifab cherry treeifáb cherry, ifabet privet
ufab prune treeufáb prune
ófab apricot treeófáb apricot
áfab peach treeáfáb peach
éfab quince treeéfáb quince
ífab walnut treeífáb walnut
úfab hazelnut treeúfáb hazelnut
alofàb blackberry vinealofáb blackberry
lafab orange treelafáb orange
lefab mandarin treelefáb mandarin
lifab lemon treelifáb lemon
lufab grapefruit treelufáb grapefruit
fefab date treefefáb date
fifab banana treefifáb banana
fufab cononut treefufáb coconut
fófab pomegranite treefófáb pomegranite
fífab fig treefífáb fig
vafàb grape vinevafáb grape, vafàbem vineyard, vafábil grape juice, vafil wine, vafilsam winery, ígvafil vinaiger, vafilifud oinophile
cafàb tea plantcafaéb tea leaf, tea, cafil tea (drink), cafilam tea house
cefàb coffee plantcefáb coffee bean, coffee, cefil coffee (drink), cefilam cafe
cifàb blackcurrant bushcifáb blackcurrant
cufàb raspberry bushcufáb raspberry
cófàb currant bushcófáb currant
sifàb pepper plantsifáb pepper, sifáber to pepper, sifábika peppery
kafab olive treekafáb olive, kafábél olive oil
rafab oak treerafáb acorn
refab beech treerefaob beechwood
rifab chestnut treerifáb chestnut
rufab plane tree 
rófab poplar tree'rófaob poplar wood
ráfab birch treeráfaob birchwood
réfab locust tree 
rífab chestnut treefífáb chestnut
rúfab willow treerúafab weeping willow
ralafab lime tree, lindenralafáb lime
ralefab maple treeralefaob maplewood
ralofab elm treeralofaob elmwood
dofab evergreen treedofáb cone
dafab fir tree 
defab pine treedefáb pine cone, defaéb pine needle, defaob pine (wood)
dufab cypress treedufaob cypress wood

Plants, vegetables, grains, and legumes

[edit | edit source]
vob plantvober to plant, vobem plantation, vobud planter, vobier to harvest, vobijob harvest (time), vobésam farm, vobyesud farmer
vab grassvabem grassland, prairie, vabema rural, vabgorcer to mow, vabemet lawn, vabán grass (lawn), vabij germ, vabóg moss, vabib crop, harvest, vabiber to reap, vabam barn
veb ear, tuft, spike 
vib stem 
vaob hay 
vub blade, sprig, twig 
váb seedvábet seedling, váber to seed
vâb grain, bean 
vulob thorn, spinevulobika thorny
ovob cereal 
avob wheatavol bread, avolek flour
evob rye 
ivob barley 
uvob buckwheat 
óvob oatóvolek oatmeal
ávob hopávil beer
évob rapeseed, colza 
ívob rice 
gavob sunflowergaváb sunflower seed
gevob corn, maizegeváb kernel, gevobek cornmeal
givob tobaccogivoc cigar, givocet cigarette, givov tobacco smoke
favob cottonfaváb cottonseed, favof cotton fabric
fevob flax 
fivob hempfuvov marijuana, pot
fuvob jute 
zavob strawberry bushzaváb strawberry
cavob fern 
cevob thistle 
civob nettle 
savob mushroom 
zevob basil 
zivob thyme 
zuvob rosemary 
ováb legume, bean 
aváb green bean
eváb lentil 
iváb pea 
uváb broad bean 
óváb lima bean 
vol vegetablevolinud vegetarian, volem vegetable garden, volcer to vegetate
lovol tuber 
lavol potato 
levol beetlevel sugar, levela sweet
livol radish 
luvol carrot 
lávol artichoke 
lóvol turnip 
favol leek 
fevol onion 
fivol shallot 
fuvol garlic 
pavol cabbage 
pevol cauliflower 
bavol tomatobavil tomato juice
bevol eggplant 
bivol squash 
buvol cucumberígza buvol pickle
bávol artichoke 
bóvol gherkin 
vavol lettuce 
vevol spinach 
vivol sorrel 
vuvol dandelion 
vávol watercress 
vóvol chicory 
gavol pumpkin 
gevol melon 
givol watermelon 
zavol parsley 

Flowers and colors

[edit | edit source]
voc flowervoca floral, vocer to flower, vocen flowering, vocud florist, vocán bouquet, vocaéb petal, vocém flowerbed, vocésun horticulture
avoc lilyavoza white
evoc narcissusevoza yellow
ivoc poppyivoza red
uvoc roseuvoza pink
óvoc cornfloweróvoza blue
ávoc hydrangeaávoza mauve
évoc lilacévoza lilac
ívoc violetívoza violet
úvoc carnation 
lovoc daisy 
lavoc lily of the valley 
levoc jonquil 
livoc geranium 
luvoc forget-me-not 
lávoc tulip 
lévoc dahlia 
lóvoc hyacinthe 
elavoc iris 
elevoc primrose 
elivoc chrysanthemum 

Colors (voz)

[edit | edit source]
Change -oza to -òza to get -ish as in whitish (avòza).
Change -oza to -óza to get dark ... as in dark red (ivóza).


  voz colorvooz tint, hue
  avoza whitefrom avoc lily
  evoza yellowfrom evoc narcissus
  ivoza redfrom ivoc poppy
  uvoza pinkfrom uvoc rose
  óvoza bluefrom óvoc cornflower
  ávoza mauvefrom ávoc hydrangea
  évoza lilacfrom óvoca lilac
  ívoza violet, purplefrom ívoc violet
  vaza greenfrom vab grass
  moza blackfrom mon darkness or moj night
  maza sky bluefrom mam sky or maj day
  èmoza grayfrom è half + moza black
  meza khakifrom mel soil
  lafáza orangefrom lafáb orange
  rifáza maroonfrom rifáb water chestnut
  rífyza brownfrom rífáb chestnut
  vápeza beigefrom vápet antilope

Some Cross-thematic Analogies in Vocabulary

[edit | edit source]
humantreegrassfoodmaterial
taobfaobvaobtaolfaof
fleshwoodhaymeatboard
humantreeplantfruitfishcloth
taóbfaóbvaóbvâobpiétaóbtaóf
skinbarkhuskrindshellleather
humantreeplantflowerbirdfish
taébfaébvaébvocaébpataébpitaéb
hairleaftwigpetalfeatherscale
humantreeplantbirdfishgovernmentanimal
tubfubvubpatubpitubdubpetub
armbranchbladewingfinministerforepaw
societyhumanworkplantfish
debtebsebvebpiteb
chiefheadbosstuftfish-head
formgestureknowledgeactionsocietycitizenpeoplepersonpast+personpersonlifespeech
cénbénténséndotcénditbénudánbénutbénajutbénutcéntijbéndabén
stylemannerprofessiontradecraftcivilizationcivilitycustomhabittraditiongenrelifestyledialect
t-dt-zd-cd-zs-cs-zc-zc-s
teudteuzdeucdeuzseucseuzceuzceus
shoutvoiceaccentsongnoisemelodytonesound
t-ct-sb-ct-pt-dc-ciz-cn-cij-c
teacerteaserbeacerteaperteaderceacerizeacerneacerijeacer
to seeto lookto watchto visitto witnessto seemto showto aimto perceive


marmagmanmakmazmavmalmammapmafmaj
sunfirelightelectricitysparkleflameairskywindcloudday


mermegmekmezmefmevmelmemmebmepmejmedmet
planetrockdustgembrickporcelainsoillandmountainroadnoonparkgarden


ijtijpatijtobijatobijvobijtesij
beginningbirtheggembryogermseedidea

Nationalities

[edit | edit source]
place nameadjectiveinhabitantlanguage
AsyamAsyaAsyatn/a
AfrikamAfrikaAfrikatn/a
AlgeryamAlgeryaAlgeryatAlgerya Arabad
AlbanyamAlbanyaAlbanyatAlbanyad
AmerikamAmerikaAmerikatAmerikad
ArmenyamArmenyaArmenyatArmenyad
AfganamAfganyaAfganatn/a
ArgentinyamArgentinyaArgentinyatArgentinya Spanyad
ArabamArabaArabatArabad
BalujamBalujaBalujatBalujad
CiryamCiryaCiryatCirya Arabad
CenegalamCenegalaCenegalatCenegalad
CkotlandamCkotlandaCkotlandatCkotlandad
CpanamCpanaCpanatCpanad
CwedamCwedaCwedatCwedad
DanmarkamDanmarkaDanmarkatDanmarkad
EnglandamEnglandaEnglandatEnglandad
EuropamEuropaEuropatn/a
FrancamFrancaFrancatFrancad
FinlandamFinlandaFinlandatFinlandad
GermanyamGermanyaGermanyatGermanyad
HelvetyamHelvetyaHelvetyatHelvetyad
HolandamHolandaHolandatHolandad
ItalyamItalyaItalyatItalyad
IrlandamIrlandaIrlandatIrlandad
KanadamKanadaKanadatKanada Englandad/Francad
LugandamLugandaLugandatLugandad
NairobamNairobaNairobatNairobad
Omir-AfrikamOmir-AfrikaOmir-AfrikatOmir-Afrika Holandad
PakistanamPakistanaPakistanatn/a
RodesyamRodesyaRodesyatn/a
SetlandamSetlandaSetlandatn/a
TailandamTailandaTailandatTailandad
UgandamUgandaUgandatUgandad
VietnamVietnamaVietnamatVietnamad
ZululandamZululandaZululandatZululandad


Word-building · Grammar

Word-building · Mirad · Grammar
Orthography and Pronunciation · Word-building · Word Families · Grammar · Conversation Lessons ·  v  d  e